Zepteon

 

High Purity FcgammaR3A Receptor Zepteon is the lowest cost supplier of FCGR3A receptor. The extracellular portion of the receptor is derived from a stable CHO clone and fully glycosylated. It is purified using IMAC and SEC to >97% monomer, tested for activity using western blot and shown to be low in endotoxin. The protein is also called: Homo sapiens (Human) Accession AAH17865. CD16a antigen, Fc-gamma RIIIa, FcGR3, FcGR3A, IgG Fc receptor III-2, CD16a. See the attached data sheet for more information.

Cost of FcgammaR3A Receptor

1 mg: $1,000.00

5 mg: $4,000.00

View Cart

Protein: FCGR3A [Homo sapiens (Human)] Accession AAH17865. CD16a antigen, Fc-gamma RIIIa, FcGR3, FcGR3A, IgG Fc receptor III-2, CD16a

Sequence: GLY17-GLN208 GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAA
TVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYL
QNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPP
GYQGGGLPETGHHHHHH

Host: CHO cell

Characterization:Molecular Mass:22.6 kDa, 40-50 kDa on SDS PAGE due to glycosylation

Purity: >97% monomer by SDS-PAGE and HPLC SEC after IMAC-Ni and SEC purification

Endotoxin Level: < 0.5 EU/mg

Activity: ELISA and Western blot

Formulation:5-10 mg/mL FCGR3A in 10 mM

MES 25 mM NaCl pH 6.0

Shipping: Liquid with ice packs

Stability and Storage: receptor is stable at 2-8 C for more than 30 days and more than a year at -80 C

Please contact us for more information or to purchase resin or receptor (Email Zepteon Info) or (Email Zepteon Sales).

Zepteon

3503 Jack Northrop Ave Suite # O4692 Hawthorne, CA 90250 USA

877-222-5108